DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlN

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:307 Identity:170/307 - (55%)
Similarity:196/307 - (63%) Gaps:62/307 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVLCFIALATADKLGYNYQPVAHSPSGLSFQP-SGSAS------------SDAPAFAPAPS 52
            ||:|||||.:|:|:||||||||:||.||.|||||.| |||.|            |.........|
  Fly     1 MRAFVVLCLVAIASADKLGYNYKPVGHSSSGLSFAPGSGSLSLGGGGGSLGLGGSSGSLDLGGAS 65

  Fly    53 ASFAPGPSSIADALE---------------------------------------------GSQSA 72
            .|...|..|...:|:                                             ||...
  Fly    66 GSLGLGGGSNFGSLDGGFGGLGGGSIDLGSSGLGSSGLGSGLGSSGLGSGLGSSGLGSGLGSAGL 130

  Fly    73 AAP---NYAAPQAQLEKEFFTYTADEGDFYDPSASDRVANAVNKGLRVVFIKGPENSGLEDAALA 134
            :||   |..||.|:|:||||||||:|.||.:|.|.:|||::|||||||||||||||.|||:||||
  Fly   131 SAPVSYNAPAPAAELQKEFFTYTANEEDFDEPQALERVASSVNKGLRVVFIKGPENRGLENAALA 195

  Fly   135 LAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQ 199
            |||||||||||||||||||||||||.|||:||:|:|||||||||||||||||||||.|||.||||
  Fly   196 LAKQAAQQETAIYVLNKQADIGDLAQKLNAIRSNSNNKPEVHFVKYRTPEDAANAQRAIQSQYDQ 260

  Fly   200 LGGSSQSQNGGVASTLNFASQPAPRESTAASAPGPSYLPANIFRRFR 246
            ||||||:.|||||:.|||||....|::| |..|..||||:::.||.|
  Fly   261 LGGSSQAINGGVANALNFASAGPVRQAT-AQIPENSYLPSSVLRRLR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 83/100 (83%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 83/100 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443785
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.