DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlO

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster


Alignment Length:254 Identity:139/254 - (54%)
Similarity:172/254 - (67%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVLCFIALATADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSASFAPGPSSIADA 65
            ||..:..|.|..|.|.   |||        |..|  :|:||.:.|:::          .||:.|:
  Fly     1 MRFLIAFCLIGAACAQ---YNY--------GAGF--TGAASDNVPSYS----------GSSVGDS 42

  Fly    66 LEGSQSAAAPNYAAPQAQLEKEFFTYTADEGDFYDPSASDRVANAVNKGLRVVFIKGPENSGLED 130
            .:|  :|::|:|:. .::|.||::|:.|||..|.||.|:.::|.:|||||||||||||||.|||:
  Fly    43 YDG--AASSPDYSV-SSELNKEYYTFEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLEN 104

  Fly   131 AALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQG 195
            ||||||||||:|.|||||||||.||||||.|.|:.|.|:|.:||||||||||||||||||.|||.
  Fly   105 AALALAKQAAEQRTAIYVLNKQTDIGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQS 169

  Fly   196 QYDQLGGSSQSQNGGVASTLNFASQ----PA---PRESTAASAPGPSYLPANIFRRFRV 247
            |||.|||||||.|||||:.:||||.    ||   |..|..|:|...|||||||.||.|:
  Fly   170 QYDNLGGSSQSINGGVANAINFASAAPVVPARRGPNYSPPAAATSNSYLPANILRRLRI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 70/100 (70%)
TwdlONP_651487.1 DM5 56..157 CDD:214776 70/100 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.