DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlP

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster


Alignment Length:248 Identity:131/248 - (52%)
Similarity:157/248 - (63%) Gaps:31/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVLCFIALATADKL-GYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSASFAPGPSSIAD 64
            ||:.::|..:|.|:|..| ||||...|.:..|      ||..|..||.|         ||.|.: 
  Fly     1 MRALIILSIVAAASAGSLSGYNYGQGATTSIG------GSGVSPVPALA---------GPVSYS- 49

  Fly    65 ALEGSQSAAAPNYAAPQAQLEKEFFTYTADEGDFYDPSASDRVANAVNKGLRVVFIKGPENSGLE 129
                         |||||.:.|||:::.|::.||.|.:|..|...:|.|.:||:|||.|||.|.|
  Fly    50 -------------AAPQASVHKEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPENRGYE 101

  Fly   130 DAALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQ 194
            :|.||||||||||:||||||:||.||.:||.|.|::|.|.|.|||||||||||||||||||.|||
  Fly   102 NAVLALAKQAAQQQTAIYVLHKQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQ 166

  Fly   195 GQYDQLGGSSQSQNGGVASTLNFASQ-PAPRESTAASAPGPSYLPANIFRRFR 246
            .|||||||||||.|||||:.:||||| .||...|....|..:||||||..|.|
  Fly   167 SQYDQLGGSSQSINGGVANAINFASQGAAPARVTPQQVPQSNYLPANILSRLR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 60/100 (60%)
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 56/94 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.