DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlW

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_650606.2 Gene:TwdlW / 42075 FlyBaseID:FBgn0038487 Length:308 Species:Drosophila melanogaster


Alignment Length:317 Identity:97/317 - (30%)
Similarity:130/317 - (41%) Gaps:84/317 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFV-----VLCFIALATAD----KLGYNY---------QP--VAH------------------ 27
            |:.||     .:| ::|:.||    :.||||         ||  |||                  
  Fly     1 MKIFVTVLMGAMC-LSLSQADISLTQAGYNYRIQQQQQQQQPPIVAHLLNQQLQQQQQLQPQQSS 64

  Fly    28 ----SPSGLSF-QPSGSASSDAPAFAPAPSASFAPG--PSSIADALEGSQSAAAPNYAAPQAQL- 84
                .|..|.: .|:|...|..||..|...:...|.  |.:...|....|..|.|....|:..: 
  Fly    65 HPVLPPLPLPYLPPAGQFHSAQPAVRPTAGSFPMPAGFPVNFQTAPIQQQRRARPRVRIPKRPIV 129

  Fly    85 EKEFFTYTADEGDFYDPSASDRVANAVNK-------GLRVVFIKGPENSGLEDAALALAKQAAQQ 142
            .|.||.::|.|      .:.|.|.:.:|:       ...|:|:|.|..:. ..|||.|||...|:
  Fly   130 TKNFFIHSAPE------ESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTN-RAAALNLAKTLKQE 187

  Fly   143 ETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQSQ 207
            :|.:|||.|:....||.:.: :....:.|||||.|:||||||:|.|||..||.|||.|||||...
  Fly   188 KTVVYVLAKKTTASDLQDAI-AEAPQHINKPEVFFIKYRTPEEALNAQRQIQSQYDTLGGSSTIT 251

  Fly   208 NGGVASTLNFASQPAPRE-------------------STAASAPGP---SYLPANIF 242
            :.|||...:......|.|                   ....|..||   .|||||.|
  Fly   252 DEGVAPITSVVGSLDPPEEEEEEQQQQQHSEGQFAENGAGNSGVGPIGNHYLPANQF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 35/108 (32%)
TwdlWNP_650606.2 DM5 127..227 CDD:214776 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.