DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlV

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_649446.1 Gene:TwdlV / 40537 FlyBaseID:FBgn0037227 Length:251 Species:Drosophila melanogaster


Alignment Length:280 Identity:85/280 - (30%)
Similarity:123/280 - (43%) Gaps:70/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVLCFIALATADKLGYNYQPVAHSPSGL----SFQPSGSASSDAPAFAPA-PSASFAPGPS 60
            |..|:|||..::|.|...||||.|   .|||.    :....||....|...||. |.|.:     
  Fly     1 MSGFIVLCLCSVALAAPQGYNYNP---GPSGFGGISTTTGGGSFFQGAVQVAPVQPQAVY----- 57

  Fly    61 SIADALEGSQSAAAPNYAAPQAQLE-------KEFFTYTADEGDFYDPSASDRVANAVNKGL--- 115
                     |..||..:...|.|::       |.||.::|.|      .|.|.....:..|:   
  Fly    58 ---------QQPAAQTHHHQQQQVQQQQAIVSKRFFIHSAPE------EAEDYKERHITVGVPKR 107

  Fly   116 --RVVFIKGPENSGLEDAALALAKQAAQQETAIYVLNKQADIGDLANKLNS---IRNNNNNKPEV 175
              .|||||.|:.:..:  .:.::..|.:::|.||||:|:.:     :.||:   .:.::.:||||
  Fly   108 NYNVVFIKSPQRNNRK--TIKISPAANEEKTVIYVLSKKGE-----SDLNAEVVEQASSTSKPEV 165

  Fly   176 HFVKYRTPEDAANAQSAIQGQYDQLGGSSQSQNGGVASTLNFASQPAPRE--------------- 225
            .|:||:|.|:||:||..||.|||.||||||..:.|||...:........:               
  Fly   166 FFIKYKTNEEAAHAQQQIQAQYDALGGSSQLTDEGVAPVTSVIGALGGSDGHIDGGSVVGATGAG 230

  Fly   226 -----STAASAPGPSYLPAN 240
                 .||.|..|.:|||.|
  Fly   231 QIVSTGTAGSHTGNAYLPPN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 31/115 (27%)
TwdlVNP_649446.1 DM5 78..173 CDD:214776 30/107 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.