DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlG

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster


Alignment Length:299 Identity:92/299 - (30%)
Similarity:124/299 - (41%) Gaps:81/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVLCFIALATADKLGYNYQPVAHSPSGLSFQPSGSASS----DAPAFA------------P 49
            |..|:|.|.:.||.....|||||      :....|.|..|..    ..|.||            .
  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQ------AQQQLQSSAQAGQLHLPSIPQFATLAEQTILQQALQ 59

  Fly    50 APS-----------ASFAP--------------GPSSIADALEGSQSAAAPNYAAPQAQ--LEKE 87
            ||.           ||::.              ||:|..:||        |....||.|  :.|:
  Fly    60 APKLQQVLTGGEGLASYSNQNQASAYQQQATQFGPNSAYNAL--------PQAHQPQQQHLVSKD 116

  Fly    88 FFTYT--ADEGDFYDPSASDRVANAV------NKGLRVVFIKGPENSGLEDAALALAKQAAQQET 144
            .:.:.  |:|.:       ||....|      .|..|:||||.|..| :..|||.:.:...:::|
  Fly   117 IYVHVPPAEEPE-------DRYPQPVLPPAPPRKHYRIVFIKAPTTS-VSKAALRIKQAPVEEKT 173

  Fly   145 AIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQSQNG 209
            .||||.|:.|..||...:..|.....:||||.|:||:|.|:||:||..||.|||||||:||..:.
  Fly   174 IIYVLTKKPDPLDLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDE 238

  Fly   210 GVASTL-------NFASQPAPRESTAASAPGPSYLPANI 241
            |||...       |..:........:.|.|. ||||.|:
  Fly   239 GVAPVTSVIGVLDNQRNNGISSGQFSGSLPN-SYLPTNL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 35/110 (32%)
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 34/106 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.