DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlF

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster


Alignment Length:356 Identity:100/356 - (28%)
Similarity:139/356 - (39%) Gaps:116/356 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVL-CFIALATADKLGYNYQP-------------VAHSPSGL-------SFQPSGS--ASS 42
            |:.|||| |.:||......||.|||             ...|.||:       ||..:|:  |..
  Fly     1 MKQFVVLMCLVALTATAPQGYKYQPQLPALPIGNLRPLTPISSSGIYASGAVPSFPQAGAQPAIG 65

  Fly    43 DAPAF--------APAPSASFAPGPSSIADALEGSQSAAAPN---------------YAAPQAQL 84
            ..||.        ||||:.  ||.|.||:...|...:|:...               ...||..|
  Fly    66 VQPAIQAVQTIVAAPAPAP--APAPLSISLPKETFLTASPQQNLISTVQQQPQQIVYQQQPQQAL 128

  Fly    85 EKEFFTYTA-DEGDFYDPSASDR----------VANA-VNKGLRVVFIKGP-ENSGLEDAALALA 136
            :.:|....| ...|.|..||.:.          :.|. :.|..|:||||.| :|.....|||..|
  Fly   129 QTQFVQRPAIVTKDIYIHSAPEENEELRQDEPLLENVPIRKNYRIVFIKAPSQNLKYTAAALKRA 193

  Fly   137 KQAAQQETAIYVLNKQADIGDLANKLNSIRNNNN-NKPEVHFVKYRTPEDAANAQSAIQGQYDQL 200
            :.:.:::|.||||:|:.|:.::..:|...::... .||||:|:||:|.|:|..||..||.|||.|
  Fly   194 QSSNEEKTVIYVLSKKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYDAL 258

  Fly   201 GGSSQSQNGGVA-------STLNFAS-------------------------QPAPR--------- 224
            ||::...:.|||       .:||..|                         ||..:         
  Fly   259 GGATHISDEGVAPIASVSSGSLNLGSFVPQHSQAGQTIIHSQAPTIIQPQGQPIVQLQSINQGVQ 323

  Fly   225 -------------ESTAASAPGPSYLPANIF 242
                         .|.|.|||...|:||..|
  Fly   324 GVQQQSSFVQKSTSSFAPSAPSRKYVPAKTF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 35/114 (31%)
TwdlFNP_649443.1 DM5 137..241 CDD:214776 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.