DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlR

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_733161.2 Gene:TwdlR / 318586 FlyBaseID:FBgn0051081 Length:325 Species:Drosophila melanogaster


Alignment Length:249 Identity:88/249 - (35%)
Similarity:129/249 - (51%) Gaps:43/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVLCFIALATADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSASFAPGPSSIADA 65
            |...|.|..:|.::|: |||.||  .:|..|    |..|..::|                .:.|.
  Fly    11 MLGIVFLTLLAGSSAE-LGYQYQ--QNSYGG----PVNSYGNEA----------------VLGDE 52

  Fly    66 LEGSQSAAAPNYAAPQAQLEKEFFTYTA-----DEGDFYDPSASDRVANAVNKGLRVVFIKGPEN 125
            ...||..   |:....|...|.|:.:.|     :|.|.    |..::::...|.|:|||||.|||
  Fly    53 RYHSQPG---NHYQENADFHKHFYAFEAPYDSVEEVDL----AETKLSSLAQKNLQVVFIKAPEN 110

  Fly   126 SGLEDAALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQ 190
            ..:..|..|||||.::.:|||||||||.|:.:||::|::::.::.:||:||||||:|.|:||.||
  Fly   111 KAVVGALNALAKQTSEDKTAIYVLNKQTDVNELASQLSALKAHHKHKPQVHFVKYKTEEEAAQAQ 175

  Fly   191 SAIQGQYDQLGGSSQSQNGGVASTLNFASQPAPR-ESTAASAPGPS----YLPA 239
            ..||.||   ||.|.....|.||:|.:..:..|: |..|.|...|:    |||:
  Fly   176 QYIQAQY---GGGSSIPQPGKASSLGYYPEQQPQYEQDAPSEEYPAGQVGYLPS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 44/105 (42%)
TwdlRNP_733161.2 DUF243 69..165 CDD:281144 41/99 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443910
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.