DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlX

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_728016.1 Gene:TwdlX / 318094 FlyBaseID:FBgn0052571 Length:346 Species:Drosophila melanogaster


Alignment Length:277 Identity:81/277 - (29%)
Similarity:124/277 - (44%) Gaps:71/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSFVVLCFIALA----------TADKLGYNYQPVAHSPS--------------GLSFQPSGSAS 41
            |:.||||..:|:.          .:...||:||...::.:              ..|:||:.:.:
  Fly     1 MKQFVVLAVLAVIGGSLAAPRPDVSHLAGYSYQAGGYNGNLVANQVLSAPLTTVTTSYQPTAAGT 65

  Fly    42 ---SDAPAFAP------------------APSASFAPGPSSIAD-------ALEGSQSAAAPNYA 78
               |.||:...                  :.|:|:..|.||:..       .|.|.|.....||.
  Fly    66 NYYSSAPSIGQLNLGSSGSSGVVNYQVGGSGSSSYQVGSSSVGGGIVNDNIGLAGLQPGPTINYN 130

  Fly    79 APQ-----------AQLEKEFFTYTADEGDFYDPSASDRVANA--VNKGLRVVFIKGPENSGLED 130
            ..:           ||:.|.|:.::|.|.  :|.....|..|.  ..|..|||||..|.::.  .
  Fly   131 EQESYISHLANFQPAQINKHFYIHSAPED--HDEQQIVRYVNVGRPQKNYRVVFINAPTSTA--S 191

  Fly   131 AALALAKQA-AQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQ 194
            .|..:|..| .:::||||||:|:::..|:..::.:.| ...|||||.||||:||::||:||..||
  Fly   192 KAKIIANVAPVEEKTAIYVLSKKSNALDVTAEVVTQR-PVANKPEVFFVKYKTPQEAAHAQQTIQ 255

  Fly   195 GQYDQLGGSSQSQNGGV 211
            ..||.|||||::.|.||
  Fly   256 ANYDALGGSSETSNEGV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 37/103 (36%)
TwdlXNP_728016.1 DUF243 148..241 CDD:281144 33/97 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.