DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlK and TwdlY

DIOPT Version :9

Sequence 1:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_728017.1 Gene:TwdlY / 318093 FlyBaseID:FBgn0052570 Length:247 Species:Drosophila melanogaster


Alignment Length:264 Identity:76/264 - (28%)
Similarity:109/264 - (41%) Gaps:56/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLCFIALA-TADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSASFAPGPSSIADALEG 68
            :|.|.|.:| |..:..|.|:    .||...|...||          ||......|.||....:..
  Fly     7 LVSCLILVALTQARPQYGYE----QPSSDIFIGGGS----------APVGGVGIGGSSGGGLVSI 57

  Fly    69 SQSAAAPNYAAPQAQ-----LEKEFFTYTADEGDFYDPSASDRVANAVNKGLRVVFIKGPENSGL 128
            ........|..|.:.     :.|:|:..:|.|....|......|.....|..||||||.|..   
  Fly    58 QPHRGGDKYLPPASTTLAPIINKKFYLVSAPEDHSNDGKVKHLVLGRPQKNYRVVFIKAPAG--- 119

  Fly   129 EDAALALAKQAAQQE--TAIYVLNKQ---ADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAAN 188
            ::|.:..:.:.|.||  |.||||:|:   .|..|:|....:    ..:||||.|:||:|.::|..
  Fly   120 DNANVKYSAEFAPQEEKTVIYVLSKKDNDVDASDIATPAPT----QPSKPEVFFIKYKTDDEAKQ 180

  Fly   189 AQSAIQGQYDQLGGSSQSQ---NGGVASTL---------------NFASQPAPRESTAASAPGPS 235
            ||..||||||:|||:::.|   |..:.|.:               ..|::|      .|..|...
  Fly   181 AQQEIQGQYDKLGGTNEYQEDNNAPITSVIGSLDGLNPDGSYNYRQIANRP------PAVVPNSQ 239

  Fly   236 YLPA 239
            |||:
  Fly   240 YLPS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlKNP_651488.1 DM5 82..183 CDD:214776 34/110 (31%)
TwdlYNP_728017.1 DM5 76..175 CDD:214776 34/105 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.