DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlT

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster


Alignment Length:286 Identity:60/286 - (20%)
Similarity:92/286 - (32%) Gaps:88/286 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLIAFCLIGAAC---AQYNY-----------------GAGFTGAASDNVPSYSGSSVGDSYDGAA 47
            |::..||..||.   |.|||                 |.||.|.:|.......|...|..:.|.:
  Fly     4 FILMSCLALAAARPEAGYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGS 68

  Fly    48 SSPDYSV----------------------------------------------------SSELNK 60
            ....:|.                                                    ::.:.|
  Fly    69 GGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGTTLVQK 133

  Fly    61 EYYTFEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVL-N 124
            ..|.......|.|.........|...|..:::|||.|.....:...:.|..| .|::|.:||| .
  Fly   134 HIYVHVPPPEQEEVRQRPNLPIGQSQKHYKIIFIKAPSPPSYQAPVIPLQPQ-NEEKTLVYVLVK 197

  Fly   125 KQTDIGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQ------SQYDNLGGSSQSING 183
            |..|..|:.....|..|.|  :|||:|:||:|.:|::.....|.      :|.:...|.:...:|
  Fly   198 KPEDQQDIVIPTPAPTQPS--KPEVYFIKYKTQKDSSGISGGISGSTGGFTQTNTGNGYTSGGDG 260

  Fly   184 GVANAINFASAAPVVPARRGPNYSPP 209
            |.....:.:.:||      ..||.||
  Fly   261 GFTGGDSGSISAP------SSNYGPP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 29/101 (29%)
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.