DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlC

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:244 Identity:59/244 - (24%)
Similarity:87/244 - (35%) Gaps:70/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TGAASDNVPSYSGSSVGDSYD------GAASSPDYS---VSSELNKEYYTFEADESQFEDPLAAQ 79
            |.||::.:.:|.     |||:      |...:..|:   ..::::|..|. ......||:..|.|
  Fly    89 TAAAAEPLNAYD-----DSYNMAHRLSGVQHASGYNNGPQETKVHKHIYV-HVPPKDFEEEDAIQ 147

  Fly    80 KIA----GSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNK----QTDIGDLAQKF 136
            ...    |...|..::||||.|....:....:....| .|::|.||||:|    :.||     ..
  Fly   148 TRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQ-NEEKTLIYVLHKKPEQEQDI-----VI 206

  Fly   137 NAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANAINFASAAPVV--- 198
            .........:|||:|:||:|.:|.|..          .|.....:....|.|.:||..|.|.   
  Fly   207 PTPPPTKPSKPEVYFIKYKTKKDEAPV----------YGPPPAEMEPRQATAEDFAPLAEVADVL 261

  Fly   199 ---------------PARRGPNYSPPAAAT-------------SNSYLP 219
                           ||.....|.||.||.             :|.|||
  Fly   262 PPTTLAPAPEPEVEQPAIPSAVYGPPTAAAYTGEEVQTTLSAPANQYLP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 29/108 (27%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 29/108 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.