DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlH

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster


Alignment Length:248 Identity:129/248 - (52%)
Similarity:161/248 - (64%) Gaps:34/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFLIAFCLIGAACAQ--YNY----GAGFTGAASDNVPSYSGSSVGDSYD------GAASSPDYS 53
            ||.|||.||:.|..|:  |||    .|....:.:.:.|||| .||..|.|      ..||:|:.:
  Fly     1 MRVLIALCLVAAVSARSGYNYQPAASAPAVASFAPSGPSYS-PSVAASQDAPAETYAPASAPEAA 64

  Fly    54 VS----------SELNKEYYTFEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALA 108
            .|          :||.||::|:.|||..|.:|..:|:::.|:||.|||:|||||||.||||||:|
  Fly    65 PSAVATNYAAPQAELQKEFFTYTADEQDFVEPAGSQQVSASLNKALRVIFIKGPENTGLENAAVA 129

  Fly   109 LAKQAAEQRTAIYVLNKQTDIGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDN 173
            |||||.:|.|||||||||.|||||:.|.|:.|.|:|.:||||||||||.:||.|||:|||||||.
  Fly   130 LAKQAGQQETAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQSQYDQ 194

  Fly   174 LGGSSQSINGGVANAINFAS--AAPVVPARRGPNYSPPAAATSNSYLPANILR 224
            |||||..:|||||..:||||  ||..|.|...|         .:|||||::||
  Fly   195 LGGSSTILNGGVAPVLNFASQPAAQQVAAPSAP---------GSSYLPASVLR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 65/100 (65%)
TwdlHNP_651490.1 DM5 77..178 CDD:214776 65/100 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.