DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlN

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:213 Identity:136/213 - (63%)
Similarity:160/213 - (75%) Gaps:13/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GAGFTGAASDNVPSYSGSSVGDSYDGAASSPDYSV---SSELNKEYYTFEADESQFEDPLAAQKI 81
            |.|.:|..|....|..||.:|.:  |.::...|:.   ::||.||::|:.|:|..|::|.|.:::
  Fly   106 GLGSSGLGSGLGSSGLGSGLGSA--GLSAPVSYNAPAPAAELQKEFFTYTANEEDFDEPQALERV 168

  Fly    82 AGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNKQTDIGDLAQKFNAARQNSNQR 146
            |.|||||||||||||||||||||||||||||||:|.|||||||||.||||||||.||.|.|||.:
  Fly   169 ASSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQADIGDLAQKLNAIRSNSNNK 233

  Fly   147 PEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANAINFASAAPVVPARRGPNYSPPAA 211
            ||||||||||||||||||||||||||.||||||:||||||||:|||||.||..|        .|.
  Fly   234 PEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAINGGVANALNFASAGPVRQA--------TAQ 290

  Fly   212 ATSNSYLPANILRRLRIR 229
            ...|||||:::|||||.|
  Fly   291 IPENSYLPSSVLRRLRYR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 75/100 (75%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 75/100 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443791
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.