DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlJ

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster


Alignment Length:272 Identity:144/272 - (52%)
Similarity:181/272 - (66%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RFLIAFCLIGAACAQ-----YNY--------GAGF--TGAASDNVPSYS----------GSSVGD 41
            :|.:..||..|..|:     |||        |..|  :|:||.:.|:::          .||:.|
  Fly     3 QFSVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSESFGPGPSSIAD 67

  Fly    42 SYDG--AASSPDYSV-SSELNKEYYTFEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLE 103
            :.:|  :|::|:|:. .::|.||::|:.|||..|.||.|:.::|.:|||||||||||||||||||
  Fly    68 ALEGSQSAAAPNYAAPQAQLEKEFFTYTADEGDFYDPAASDRVANAVNKGLRVVFIKGPENRGLE 132

  Fly   104 NAALALAKQAAEQRTAIYVLNKQTDIGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQ 168
            :||||||||||:|.|||||||||.||||||.|.|:.|.|:|.:||||||||||||||||||.|||
  Fly   133 DAALALAKQAAQQETAIYVLNKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQ 197

  Fly   169 SQYDNLGGSSQSINGGVANAINFAS-AAPV------VPARRGP-----------NYSPPAAATSN 215
            .|||.||||||:.:||||:.:|||| .|||      .||:..|           :|.|||...| 
  Fly   198 GQYDQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPPATPGS- 261

  Fly   216 SYLPANILRRLR 227
            ||||||||||||
  Fly   262 SYLPANILRRLR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 71/100 (71%)
TwdlJNP_651489.2 DM5 85..186 CDD:214776 71/100 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443790
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.