DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlP

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster


Alignment Length:235 Identity:141/235 - (60%)
Similarity:163/235 - (69%) Gaps:24/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRFLIAFCLIGAACA----QYNYGAGFT----GAASDNVPSYSGSSVGDSYDGAASSPDYSVSSE 57
            ||.||...::.||.|    .||||.|.|    |:....||:.:|..   ||..|   |..||   
  Fly     1 MRALIILSIVAAASAGSLSGYNYGQGATTSIGGSGVSPVPALAGPV---SYSAA---PQASV--- 56

  Fly    58 LNKEYYTFEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYV 122
             :||:|:|.|::..|||..|.|:...||.|.:||:|||.|||||.|||.||||||||:|:|||||
  Fly    57 -HKEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPENRGYENAVLALAKQAAQQQTAIYV 120

  Fly   123 LNKQTDIGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVAN 187
            |:|||||.:|||||||.|||:|::||||||||||||||||||||||||||.||||||||||||||
  Fly   121 LHKQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQSINGGVAN 185

  Fly   188 AINFASAAPVVPARRGPNYSPPAAATSNSYLPANILRRLR 227
            ||||||.. ..|||..|...|     .::|||||||.|||
  Fly   186 AINFASQG-AAPARVTPQQVP-----QSNYLPANILSRLR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 66/100 (66%)
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 63/94 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.