DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlW

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_650606.2 Gene:TwdlW / 42075 FlyBaseID:FBgn0038487 Length:308 Species:Drosophila melanogaster


Alignment Length:179 Identity:68/179 - (37%)
Similarity:87/179 - (48%) Gaps:35/179 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EADESQFEDPLAAQKIAGSVNKGLRVVFIKGP--ENRGLENAALALAKQAAEQRTAIYVLNKQTD 128
            |..|.:.:|.|  .::|........|:|:|.|  .||.   |||.|||...:::|.:|||.|:|.
  Fly   140 EESEDEVQDEL--NQLAQQPRNHYNVLFVKTPAQTNRA---AALNLAKTLKQEKTVVYVLAKKTT 199

  Fly   129 IGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANAINFAS 193
            ..||......|.|:.| :|||.|:||||||:|.||||.||||||.|||||...:.||      |.
  Fly   200 ASDLQDAIAEAPQHIN-KPEVFFIKYRTPEEALNAQRQIQSQYDTLGGSSTITDEGV------AP 257

  Fly   194 AAPVVPARRGP---------------NYSPPAAATS------NSYLPAN 221
            ...||.:...|               .::...|..|      |.|||||
  Fly   258 ITSVVGSLDPPEEEEEEQQQQQHSEGQFAENGAGNSGVGPIGNHYLPAN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 35/92 (38%)
TwdlWNP_650606.2 DM5 127..227 CDD:214776 35/92 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.