DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlF

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster


Alignment Length:152 Identity:54/152 - (35%)
Similarity:84/152 - (55%) Gaps:16/152 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LNKEYYTFEADESQFE----DPLAAQKIAGSVNKGLRVVFIKGP-ENRGLENAALALAKQAAEQR 117
            :.|:.|...|.|...|    :||....   .:.|..|:||||.| :|.....|||..|:.:.|::
  Fly   139 VTKDIYIHSAPEENEELRQDEPLLENV---PIRKNYRIVFIKAPSQNLKYTAAALKRAQSSNEEK 200

  Fly   118 TAIYVLNKQTDIGDLAQKFNAARQNSN-QRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSI 181
            |.||||:|:.|:.::.|:....:..:. |:|||:|:||:|.|:|..||:.||:|||.|||::...
  Fly   201 TVIYVLSKKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYDALGGATHIS 265

  Fly   182 NGGVA-------NAINFASAAP 196
            :.|||       .::|..|..|
  Fly   266 DEGVAPIASVSSGSLNLGSFVP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 35/104 (34%)
TwdlFNP_649443.1 DM5 137..241 CDD:214776 35/104 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.