DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and Twdlalpha

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_728020.1 Gene:Twdlalpha / 326223 FlyBaseID:FBgn0052574 Length:388 Species:Drosophila melanogaster


Alignment Length:239 Identity:66/239 - (27%)
Similarity:106/239 - (44%) Gaps:66/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIGAACAQY---NYGAG-----FTGAASDNVPSYSGSSVGDSY----DGAASS------------ 49
            |:|::.|.:   :||.|     .||..:.:..:||....|.:|    :||..|            
  Fly    70 LVGSSSAPHSVSHYGGGNGATYTTGGGNGHAATYSTGGHGATYSTGGNGATYSTGGSSNYGGSSF 134

  Fly    50 -------------------PDYSVSSE-----------LNKEYYTFEADESQFEDPLAAQKIAGS 84
                               |.|....|           ::|:::|..|.|.......:...:.|.
  Fly   135 TGFGPTPNIGFGALAGYQAPTYQQQQEQEVQRGFQEPIIHKQFFTVAAPEEHENLERSKHLVIGR 199

  Fly    85 VNKGLRVVFIKGPENRGLENAALALAKQAA--EQRTAIYVLNK---QTDIGDLAQKFNAARQNSN 144
            ..|..||||||.|.:   .||.:.|:.:.|  |::|.||||:|   |.::.|:|    .......
  Fly   200 PQKNYRVVFIKAPSS---SNANVKLSAEYAPKEEKTVIYVLSKKDNQLEVNDIA----TPAPTVP 257

  Fly   145 QRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANA 188
            .:|||.|:||:|..:|::||:.||::||.:.|:|:..:||||.|
  Fly   258 SKPEVFFIKYKTDAEASHAQQQIQAEYDRIEGTSEHQDGGVAPA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 34/116 (29%)
TwdlalphaNP_728020.1 DM5 171..270 CDD:214776 33/105 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.