DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlR

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_733161.2 Gene:TwdlR / 318586 FlyBaseID:FBgn0051081 Length:325 Species:Drosophila melanogaster


Alignment Length:221 Identity:80/221 - (36%)
Similarity:119/221 - (53%) Gaps:12/221 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIAFCLIGAACAQ--YNYGAGFTGAASDNVPSYSGSSV-GDSYDGAASSPDYSVSSELNKEYYTF 65
            ::...|:..:.|:  |.|.....|..   |.||...:| ||....:.....|..:::.:|.:|.|
  Fly    14 IVFLTLLAGSSAELGYQYQQNSYGGP---VNSYGNEAVLGDERYHSQPGNHYQENADFHKHFYAF 75

  Fly    66 EADESQFED-PLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNKQTDI 129
            ||.....|: .||..|::....|.|:|||||.|||:.:..|..|||||.:|.:|||||||||||:
  Fly    76 EAPYDSVEEVDLAETKLSSLAQKNLQVVFIKAPENKAVVGALNALAKQTSEDKTAIYVLNKQTDV 140

  Fly   130 GDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANAINFASA 194
            .:||.:.:|.:.:...:|:||||||:|.|:||.||:.||:||   ||.|.....|.|:::.:...
  Fly   141 NELASQLSALKAHHKHKPQVHFVKYKTEEEAAQAQQYIQAQY---GGGSSIPQPGKASSLGYYPE 202

  Fly   195 APVVPARRGPNYSPPAAATSNSYLPA 220
            ......:..|:...||...  .|||:
  Fly   203 QQPQYEQDAPSEEYPAGQV--GYLPS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 47/101 (47%)
TwdlRNP_733161.2 DUF243 69..165 CDD:281144 45/95 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443892
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.