DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlX

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_728016.1 Gene:TwdlX / 318094 FlyBaseID:FBgn0052571 Length:346 Species:Drosophila melanogaster


Alignment Length:264 Identity:77/264 - (29%)
Similarity:116/264 - (43%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NYGAGFTGAASDNVPSYS--GSSVGDSYDGAASSPDYSVS----------------SELNKEYYT 64
            ||..|.:|::|..|.|.|  |..|.|:...|...|..:::                :::||.:|.
  Fly    89 NYQVGGSGSSSYQVGSSSVGGGIVNDNIGLAGLQPGPTINYNEQESYISHLANFQPAQINKHFYI 153

  Fly    65 FEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQA-AEQRTAIYVLNKQTD 128
            ..|.|...|..:......|...|..|||||..|.:..  :.|..:|..| .|::||||||:|:::
  Fly   154 HSAPEDHDEQQIVRYVNVGRPQKNYRVVFINAPTSTA--SKAKIIANVAPVEEKTAIYVLSKKSN 216

  Fly   129 IGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGV-------- 185
            ..|:..:....|..:| :|||.||||:||::||:||:.||:.||.|||||::.|.||        
  Fly   217 ALDVTAEVVTQRPVAN-KPEVFFVKYKTPQEAAHAQQTIQANYDALGGSSETSNEGVIPVSSVIG 280

  Fly   186 --------------ANAINFASAAPVVPARRGPNYSPP---------------AAATSNSYLPAN 221
                          :.::|......|.....|.:|...               |.||   |||..
  Fly   281 SLGDNGASGVLTDASGSVNIVGTGGVPTVDAGASYDAEGSQRQVISTVTTGTNAQAT---YLPVK 342

  Fly   222 ILRR 225
            .:|:
  Fly   343 PVRK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 35/101 (35%)
TwdlXNP_728016.1 DUF243 148..241 CDD:281144 33/95 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.