DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlY

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_728017.1 Gene:TwdlY / 318093 FlyBaseID:FBgn0052570 Length:247 Species:Drosophila melanogaster


Alignment Length:254 Identity:77/254 - (30%)
Similarity:114/254 - (44%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIAFCLIGAACA----QYNY-----------------GAGFTGAASDNVPSYSGSSVGDSYDGAA 47
            ::..|||..|..    ||.|                 |.|..|::...:.|......||.|...|
  Fly     6 VLVSCLILVALTQARPQYGYEQPSSDIFIGGGSAPVGGVGIGGSSGGGLVSIQPHRGGDKYLPPA 70

  Fly    48 SSPDYSVSSELNKEYYTFEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQ 112
            |:   :::..:||::|...|.|....|......:.|...|..||||||.|..   :||.:..:.:
  Fly    71 ST---TLAPIINKKFYLVSAPEDHSNDGKVKHLVLGRPQKNYRVVFIKAPAG---DNANVKYSAE 129

  Fly   113 AA--EQRTAIYVLNKQ---TDIGDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYD 172
            .|  |::|.||||:|:   .|..|:|..  |..|.|  :|||.|:||:|.::|..||:.||.|||
  Fly   130 FAPQEEKTVIYVLSKKDNDVDASDIATP--APTQPS--KPEVFFIKYKTDDEAKQAQQEIQGQYD 190

  Fly   173 NLGGSSQSINGGVANAINFASAAPVVPARRGPN----YS-------PPAAATSNSYLPA 220
            .|||:::      ....|.|....|:.:..|.|    |:       |||...::.|||:
  Fly   191 KLGGTNE------YQEDNNAPITSVIGSLDGLNPDGSYNYRQIANRPPAVVPNSQYLPS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 37/105 (35%)
TwdlYNP_728017.1 DM5 76..175 CDD:214776 37/105 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443886
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.