DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlO and TwdlZ

DIOPT Version :9

Sequence 1:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_728018.2 Gene:TwdlZ / 318092 FlyBaseID:FBgn0052569 Length:210 Species:Drosophila melanogaster


Alignment Length:178 Identity:54/178 - (30%)
Similarity:91/178 - (51%) Gaps:17/178 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PDYSVSSELNKEYYTFE-ADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQA 113
            |:.::...:.|::|:.. |::.:..:|.....:.|...:..||:||:.|.... |:.........
  Fly    27 PNPAMEPIITKQFYSISPAEDPEDLEPRTKHLVIGQPRRNYRVIFIRAPTGNS-EHVKYTAELAP 90

  Fly   114 AEQRTAIYVL-NKQTDIGDLAQKFNAARQNS--NQRPEVHFVKYRTPEDAANAQRAIQSQYDNLG 175
            .|:||.|||| .||.::.  |....|.:|.|  .|:|:|.|:||:|.::||.|||.||:|||.||
  Fly    91 QEERTVIYVLTRKQQELE--AADIMAPQQKSQVEQKPDVFFIKYKTNDEAAAAQREIQTQYDQLG 153

  Fly   176 GSSQ----------SINGGVANAINFASAAPVVPARRGPNYSPPAAAT 213
            |:::          |:.|.:::....|:..||.....|.:|..|..:|
  Fly   154 GNTEIAAPYVAPIKSVIGALSSPQYPAAPYPVQRQSPGYHYDRPDRST 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlONP_651487.1 DM5 56..157 CDD:214776 30/104 (29%)
TwdlZNP_728018.2 DUF243 36..132 CDD:281144 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.