DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlL and TwdlT

DIOPT Version :9

Sequence 1:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster


Alignment Length:295 Identity:97/295 - (32%)
Similarity:129/295 - (43%) Gaps:48/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVM-CLVAVACADKLGYNY-QPVGHSSSGLSFAPG-SGSIGGGSIG--GGSIG---GGSIG 57
            |:|||:| ||...|...:.|||| :|.|...||.....| .|..||||.|  ||.||   ||..|
  Fly     1 MKAFILMSCLALAAARPEAGYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFG 65

  Fly    58 GGSIGGGLIGGG----SIGGGSIGGGSLGGSIGGGS---IDSGLGGLGGLGGLGGGDALAAPVSY 115
            |||.|||...||    |.|||..|||..||..||||   ...|.||.|.:||.|||.......:.
  Fly    66 GGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGTTL 130

  Fly   116 NAPAPAAELQKEFFTYSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAA 180
                    :||..:.:....:..:..|......|...|..:::|||.|.....:...:.|..| .
  Fly   131 --------VQKHIYVHVPPPEQEEVRQRPNLPIGQSQKHYKIIFIKAPSPPSYQAPVIPLQPQ-N 186

  Fly   181 QQETAIYVL-NKQADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSS 244
            :::|.:||| .|..|..|:.....|  ....:||||:|:||:|.:|::.....|..   ..||.:
  Fly   187 EEKTLVYVLVKKPEDQQDIVIPTPA--PTQPSKPEVYFIKYKTQKDSSGISGGISG---STGGFT 246

  Fly   245 QAHNGG------------------VAPALNFASAG 261
            |.:.|.                  .||:.|:...|
  Fly   247 QTNTGNGYTSGGDGGFTGGDSGSISAPSSNYGPPG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlLNP_733158.1 DM5 122..223 CDD:214776 26/101 (26%)
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.