DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlL and TwdlK

DIOPT Version :9

Sequence 1:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_651488.1 Gene:TwdlK / 43205 FlyBaseID:FBgn0039439 Length:247 Species:Drosophila melanogaster


Alignment Length:285 Identity:165/285 - (57%)
Similarity:186/285 - (65%) Gaps:43/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAP-GSGSIGGGSIGGGSIGGGSIGGGSIGGG 64
            ||:|:|:|.:|:|.|||||||||||.||.|||||.| ||.|....:.........:.|..||.  
  Fly     1 MRSFVVLCFIALATADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSASFAPGPSSIA-- 63

  Fly    65 LIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFF 129
                                                ..|.|..:.|||   |..||.|:|:||||
  Fly    64 ------------------------------------DALEGSQSAAAP---NYAAPQAQLEKEFF 89

  Fly   130 TYSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQAD 194
            ||:|:|.||.:|...:|||.:|||||||||||||||.|||:||||||||||||||||||||||||
  Fly    90 TYTADEGDFYDPSASDRVANAVNKGLRVVFIKGPENSGLEDAALALAKQAAQQETAIYVLNKQAD 154

  Fly   195 IGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVAPALNFAS 259
            |||||.|||:||||||||||||||||||||||||||.|||.||||||||||:.|||||..|||||
  Fly   155 IGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQSQNGGVASTLNFAS 219

  Fly   260 -AGPVQKANAQIPENAYLPTSIFRR 283
             ..|.:...|..|..:|||.:||||
  Fly   220 QPAPRESTAASAPGPSYLPANIFRR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlLNP_733158.1 DM5 122..223 CDD:214776 83/100 (83%)
TwdlKNP_651488.1 DM5 82..183 CDD:214776 83/100 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.