DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlL and TwdlO

DIOPT Version :9

Sequence 1:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster


Alignment Length:291 Identity:143/291 - (49%)
Similarity:166/291 - (57%) Gaps:74/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGL 65
            ||..|..||:..|||.   |||                                       |.|.
  Fly     1 MRFLIAFCLIGAACAQ---YNY---------------------------------------GAGF 23

  Fly    66 IGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFFT 130
            .|..|....|..|.|:|.|..|                    |.::| .|:.   ::||.||::|
  Fly    24 TGAASDNVPSYSGSSVGDSYDG--------------------AASSP-DYSV---SSELNKEYYT 64

  Fly   131 YSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQADI 195
            :.|:|..|::|...:::|||||||||||||||||||||||||||||||||:|.|||||||||.||
  Fly    65 FEADESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNKQTDI 129

  Fly   196 GDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVAPALNFASA 260
            ||||||.||.|.|:|.:||||||||||||||||||||||||||.||||||:.|||||.|:|||||
  Fly   130 GDLAQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANAINFASA 194

  Fly   261 GPVQKAN--------AQIPENAYLPTSIFRR 283
            .||..|.        |....|:|||.:|.||
  Fly   195 APVVPARRGPNYSPPAAATSNSYLPANILRR 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlLNP_733158.1 DM5 122..223 CDD:214776 74/100 (74%)
TwdlONP_651487.1 DM5 56..157 CDD:214776 74/100 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.