DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlL and TwdlB

DIOPT Version :9

Sequence 1:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster


Alignment Length:283 Identity:276/283 - (97%)
Similarity:280/283 - (98%) Gaps:0/283 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGL 65
            ||||||:|||||.||||||||||||||||||||||||||||.|||||||||||||||||||||||
  Fly     1 MRAFIVLCLVAVTCADKLGYNYQPVGHSSSGLSFAPGSGSISGGSIGGGSIGGGSIGGGSIGGGL 65

  Fly    66 IGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFFT 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 IGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFFT 130

  Fly   131 YSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQADI 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 YSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQADI 195

  Fly   196 GDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVAPALNFASA 260
            |||||||||||||||||||||||||||||||||||||||.||||||||||||:||||||||||||
  Fly   196 GDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHDGGVAPALNFASA 260

  Fly   261 GPVQKANAQIPENAYLPTSIFRR 283
            |||||||||||:|||||||:|||
  Fly   261 GPVQKANAQIPDNAYLPTSVFRR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlLNP_733158.1 DM5 122..223 CDD:214776 100/100 (100%)
TwdlBNP_651486.1 DM5 122..223 CDD:214776 100/100 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.