DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlL and TwdlW

DIOPT Version :9

Sequence 1:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_650606.2 Gene:TwdlW / 42075 FlyBaseID:FBgn0038487 Length:308 Species:Drosophila melanogaster


Alignment Length:182 Identity:76/182 - (41%)
Similarity:93/182 - (51%) Gaps:30/182 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KEFFTYSANEQDFDEPQ-ELERVAGSVNKGLRVVFIKGP--ENRGLENAALALAKQAAQQETAIY 187
            |.||.:||.|:..||.| ||.::|........|:|:|.|  .||.   |||.|||...|::|.:|
  Fly   131 KNFFIHSAPEESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRA---AALNLAKTLKQEKTVVY 192

  Fly   188 VLNKQADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVA 252
            ||.|:....|| |...|....:.|||||.|:||||||:|.||||.||||||.|||||...:.|||
  Fly   193 VLAKKTTASDL-QDAIAEAPQHINKPEVFFIKYRTPEEALNAQRQIQSQYDTLGGSSTITDEGVA 256

  Fly   253 PALN-FASAGP----------VQKANAQIPENA------------YLPTSIF 281
            |..: ..|..|          .|.:..|..||.            |||.:.|
  Fly   257 PITSVVGSLDPPEEEEEEQQQQQHSEGQFAENGAGNSGVGPIGNHYLPANQF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlLNP_733158.1 DM5 122..223 CDD:214776 43/99 (43%)
TwdlWNP_650606.2 DM5 127..227 CDD:214776 43/99 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.