DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlL and TwdlG

DIOPT Version :9

Sequence 1:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster


Alignment Length:307 Identity:93/307 - (30%)
Similarity:136/307 - (44%) Gaps:58/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKLGYNYQPVGHSSSGLSFAPGSGSIGGGSIGG-GSIGGGSIGGGSIGGG 64
            |..|||.||:.:|.....|||||    :...|..:..:|.:...||.. .::...:|        
  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQ----AQQQLQSSAQAGQLHLPSIPQFATLAEQTI-------- 53

  Fly    65 LIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAA---------PVS-YNAPA 119
                            |..::....:...|.|..||......:..:|         |.| |||..
  Fly    54 ----------------LQQALQAPKLQQVLTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALP 102

  Fly   120 PAAELQ------KEFFTY--SANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALA 176
            .|.:.|      |:.:.:  .|.|.:...||.:...| ...|..|:||||.| ...:..|||.:.
  Fly   103 QAHQPQQQHLVSKDIYVHVPPAEEPEDRYPQPVLPPA-PPRKHYRIVFIKAP-TTSVSKAALRIK 165

  Fly   177 KQAAQQETAIYVLNKQADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLG 241
            :...:::|.||||.|:.|..||...:..|.....:||||.|:||:|.|:||:|||.||:||||||
  Fly   166 QAPVEEKTIIYVLTKKPDPLDLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLG 230

  Fly   242 GSSQAHNGGVAPALNFASAGPVQKAN--------AQIPENAYLPTSI 280
            |:||..:.||||..:.......|:.|        ..:| |:||||::
  Fly   231 GTSQVSDEGVAPVTSVIGVLDNQRNNGISSGQFSGSLP-NSYLPTNL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlLNP_733158.1 DM5 122..223 CDD:214776 34/108 (31%)
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 33/100 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.