DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlL and Twdlalpha

DIOPT Version :9

Sequence 1:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_728020.1 Gene:Twdlalpha / 326223 FlyBaseID:FBgn0052574 Length:388 Species:Drosophila melanogaster


Alignment Length:324 Identity:108/324 - (33%)
Similarity:149/324 - (45%) Gaps:93/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMC-LVAVACADKLGYNY-----------QPVGHSSSGLSFAPGSGSIGG-GSIGG---- 48
            ||.|:.:| |:.::.|...||||           ...|.||.|...||...|:.. |.:|.    
  Fly     1 MRLFVTLCSLLVLSQAKPQGYNYGSGVSGSLTTSGSSGGSSGGFLTAPSHSSVASYGPLGAFQTA 65

  Fly    49 --GSIGGGSIGGGSI---GGG-----LIGGG-------SIGGG----SIGGG----SLGGSIG-G 87
              ||:.|.|....|:   |||     ..|||       |.||.    |.||.    |.|||.. |
  Fly    66 SVGSLVGSSSAPHSVSHYGGGNGATYTTGGGNGHAATYSTGGHGATYSTGGNGATYSTGGSSNYG 130

  Fly    88 GSIDSGLG-----GLGGLGGLGGGDALAAPVSYNAPAPAAE-------------LQKEFFTYSAN 134
            ||..:|.|     |.|.|.|            |.||....:             :.|:|||.:|.
  Fly   131 GSSFTGFGPTPNIGFGALAG------------YQAPTYQQQQEQEVQRGFQEPIIHKQFFTVAAP 183

  Fly   135 EQDFDEPQELER----VAGSVNKGLRVVFIKGPENRGLENAALALAKQAA--QQETAIYVLNK-- 191
            |    |.:.|||    |.|...|..||||||.|.:   .||.:.|:.:.|  :::|.||||:|  
  Fly   184 E----EHENLERSKHLVIGRPQKNYRVVFIKAPSS---SNANVKLSAEYAPKEEKTVIYVLSKKD 241

  Fly   192 -QADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVAPA 254
             |.::.|:|.....:    .:||||.|:||:|..:|::||:.||::||::.|:|:..:||||||
  Fly   242 NQLEVNDIATPAPTV----PSKPEVFFIKYKTDAEASHAQQQIQAEYDRIEGTSEHQDGGVAPA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlLNP_733158.1 DM5 122..223 CDD:214776 40/122 (33%)
TwdlalphaNP_728020.1 DM5 171..270 CDD:214776 40/109 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.