DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlL and TwdlR

DIOPT Version :9

Sequence 1:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_733161.2 Gene:TwdlR / 318586 FlyBaseID:FBgn0051081 Length:325 Species:Drosophila melanogaster


Alignment Length:228 Identity:77/228 - (33%)
Similarity:119/228 - (52%) Gaps:42/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IGGGSIDSGL----GGLGGLGGLGGGDALAAPVSYNAPAPA------AELQKEFFTYSANEQDFD 139
            :.|.|.:.|.    ...||.....|.:|:.....|:: .|.      |:..|.|:.:   |..:|
  Fly    20 LAGSSAELGYQYQQNSYGGPVNSYGNEAVLGDERYHS-QPGNHYQENADFHKHFYAF---EAPYD 80

  Fly   140 EPQELE----RVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQADIGDLAQ 200
            ..:|::    :::....|.|:|||||.|||:.:..|..|||||.::.:|||||||||.|:.:||.
  Fly    81 SVEEVDLAETKLSSLAQKNLQVVFIKAPENKAVVGALNALAKQTSEDKTAIYVLNKQTDVNELAS 145

  Fly   201 KLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVAPALNF-------- 257
            :|:|::.::.:||:||||||:|.|:||.||:.||:||   ||.|.....|.|.:|.:        
  Fly   146 QLSALKAHHKHKPQVHFVKYKTEEEAAQAQQYIQAQY---GGGSSIPQPGKASSLGYYPEQQPQY 207

  Fly   258 --------ASAG-----PVQKANAQIPENAYLP 277
                    ..||     |..:.:|..|::.|||
  Fly   208 EQDAPSEEYPAGQVGYLPSPQQSAYQPQSGYLP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlLNP_733158.1 DM5 122..223 CDD:214776 44/104 (42%)
TwdlRNP_733161.2 DUF243 69..165 CDD:281144 41/98 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.