DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlL and TwdlX

DIOPT Version :9

Sequence 1:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_728016.1 Gene:TwdlX / 318094 FlyBaseID:FBgn0052571 Length:346 Species:Drosophila melanogaster


Alignment Length:298 Identity:93/298 - (31%)
Similarity:137/298 - (45%) Gaps:69/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVMCLVAVACADKL-----------------GYN-------------------YQPVGHSS 29
            |:.|:|:.::||......                 |||                   |||....:
  Fly     1 MKQFVVLAVLAVIGGSLAAPRPDVSHLAGYSYQAGGYNGNLVANQVLSAPLTTVTTSYQPTAAGT 65

  Fly    30 SGLSFAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGLIGGGS--IGGGSIGGGSLGGSIGGGSIDS 92
            :..|.||..|.:..||.|...:....:||.       |..|  :|..|:|||.:..:|       
  Fly    66 NYYSSAPSIGQLNLGSSGSSGVVNYQVGGS-------GSSSYQVGSSSVGGGIVNDNI------- 116

  Fly    93 GLGGLGGLGGLGGGDAL-----AAPVSYNAPAPAAELQKEFFTYSANEQDFDEPQELERV-AGSV 151
                  ||.||..|..:     .:.:|:.|....|::.|.|:.:||.| |.||.|.:..| .|..
  Fly   117 ------GLAGLQPGPTINYNEQESYISHLANFQPAQINKHFYIHSAPE-DHDEQQIVRYVNVGRP 174

  Fly   152 NKGLRVVFIKGPENRGLENAALALAKQA-AQQETAIYVLNKQADIGDLAQKLNAIRNNNNNKPEV 215
            .|..|||||..|.:..  :.|..:|..| .:::||||||:|:::..|:..:: ..:....|||||
  Fly   175 QKNYRVVFINAPTSTA--SKAKIIANVAPVEEKTAIYVLSKKSNALDVTAEV-VTQRPVANKPEV 236

  Fly   216 HFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVAP 253
            .||||:||::||:||:.||:.||.|||||:..|.||.|
  Fly   237 FFVKYKTPQEAAHAQQTIQANYDALGGSSETSNEGVIP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlLNP_733158.1 DM5 122..223 CDD:214776 39/102 (38%)
TwdlXNP_728016.1 DUF243 148..241 CDD:281144 36/96 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.