DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and TwdlT

DIOPT Version :9

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster


Alignment Length:299 Identity:97/299 - (32%)
Similarity:130/299 - (43%) Gaps:56/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVL-CLVAVTCADKLGYNY-QPVGHSSSGLSFAPGSGSISGGSIGGGSIG----------G 53
            |:|||:: ||.......:.|||| :|.|...||    .|||...||..||||.|          |
  Fly     1 MKAFILMSCLALAAARPEAGYNYNRPGGGGGSG----GGSGGGLGGGFGGGSSGGFGGGIGGGFG 61

  Fly    54 GSIGGGSIGGGLIGGG----SIGGGSIGGGSLGGSIGGGS---IDSGLGGLGGLGGLGGGDALAA 111
            |..||||.|||...||    |.|||..|||..||..||||   ...|.||.|.:||.|||.....
  Fly    62 GGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGG 126

  Fly   112 PVSYNAPAPAAELQKEFFTYSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALA 176
            ..:.        :||..:.:....:..:..|......|...|..:::|||.|.....:...:.|.
  Fly   127 GTTL--------VQKHIYVHVPPPEQEEVRQRPNLPIGQSQKHYKIIFIKAPSPPSYQAPVIPLQ 183

  Fly   177 KQAAQQETAIYVL-NKQADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQL 240
            .| .:::|.:||| .|..|..|:.....|  ....:||||:|:||:|.:|::.....|.|   ..
  Fly   184 PQ-NEEKTLVYVLVKKPEDQQDIVIPTPA--PTQPSKPEVYFIKYKTQKDSSGISGGISG---ST 242

  Fly   241 GGSSQAH---------DGGV---------APALNFASAG 261
            ||.:|.:         |||.         ||:.|:...|
  Fly   243 GGFTQTNTGNGYTSGGDGGFTGGDSGSISAPSSNYGPPG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 26/101 (26%)
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.