DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and TwdlC

DIOPT Version :9

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:176 Identity:42/176 - (23%)
Similarity:74/176 - (42%) Gaps:20/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 YNAPAPAAELQKEFFTYSANEQDFDEPQELE-RV---AGSVNKGLRVVFIKGPENRGLENAALAL 175
            ||......::.|..:.: ...:||:|...:: ||   .|...|..::||||.|....:....:..
  Fly   118 YNNGPQETKVHKHIYVH-VPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPP 181

  Fly   176 AKQAAQQETAIYVLNKQADIGDLAQKLNAI----RNNNNNKPEVHFVKYRTPEDAANAQRAIQGQ 236
            ..| .:::|.||||:|:.:     |:.:.:    .....:||||:|:||:|.:|.|........:
  Fly   182 PPQ-NEEKTLIYVLHKKPE-----QEQDIVIPTPPPTKPSKPEVYFIKYKTKKDEAPVYGPPPAE 240

  Fly   237 YDQLGGSSQ-----AHDGGVAPALNFASAGPVQKANAQIPDNAYLP 277
            .:....:::     |....|.|....|.|...:.....||...|.|
  Fly   241 MEPRQATAEDFAPLAEVADVLPPTTLAPAPEPEVEQPAIPSAVYGP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 28/108 (26%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.