DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and TwdlQ

DIOPT Version :9

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651496.1 Gene:TwdlQ / 43214 FlyBaseID:FBgn0039448 Length:245 Species:Drosophila melanogaster


Alignment Length:296 Identity:115/296 - (38%)
Similarity:147/296 - (49%) Gaps:67/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVLCLVAVTCADKLGYNYQPVGHSSSGLSFAPGSGSISGGSIGGGSIGGGSIGGGSIGGGL 65
            ||.|::|.|:|...|.|||||||                               :..|.....||
  Fly     1 MRGFLLLLLIASVSAAKLGYNYQ-------------------------------AAAGDRRFAGL 34

  Fly    66 IGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNA----PAPAAELQK 126
            |...:.|..|.........                      .|....|..|.    ||.|.|..|
  Fly    35 IDAEATGFSSTSTQQQQQQ----------------------QAQQELVQQNTQQQIPAAADEFSK 77

  Fly   127 EFFTYSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNK 191
            ||:||:|.|::|.:.:..|.:|..:.:.|||:|||.||::||.||||.|||||::|.||||||:|
  Fly    78 EFYTYAAPEEEFADQEATEHIASMLKRNLRVLFIKSPEHQGLTNAALQLAKQASEQRTAIYVLSK 142

  Fly   192 QADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHDGGVAPALN 256
            |||:..|||:|.......:.|||||||||||||||..||:.||.|:|.|||||::.|.||||.|:
  Fly   143 QADVSQLAQRLANENQAQSPKPEVHFVKYRTPEDAVRAQQLIQQQFDSLGGSSRSSDEGVAPVLD 207

  Fly   257 FASAG---PVQKAN-------AQIPDNAYLPTSVFR 282
            |:||.   .||:.|       |..|...|||.::.|
  Fly   208 FSSAPAAISVQEQNEAQNQVQAVTPLTKYLPAALLR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 55/100 (55%)
TwdlQNP_651496.1 DM5 73..174 CDD:214776 55/100 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443924
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.