DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and TwdlD

DIOPT Version :9

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:301 Identity:138/301 - (45%)
Similarity:173/301 - (57%) Gaps:63/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVLCLVAVTC-ADKLGYNYQPVGHSSSGLSFAPGSGSISGGSIGGGSIGGGSIGGGSIGGG 64
            |||||||||:||:| |||||||||||.|:..||||.||||.:.                      
  Fly     1 MRAFIVLCLLAVSCSADKLGYNYQPVAHADEGLSFLPGSGQVI---------------------- 43

  Fly    65 LIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFF 129
                          |.|...:  ..:.||...|        ...:.|||:........|.||||:
  Fly    44 --------------GELPSQV--LPVQSGEAVL--------SQPIEAPVAPQIAPLVEEFQKEFY 84

  Fly   130 TYSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQAD 194
            :|:|.|:.:||....:::|.|:.|.||||||:.|||:|.|.|||.||||:||||||||||.||:|
  Fly    85 SYAAPEEQYDEGASNQQIANSLKKNLRVVFIRTPENQGFERAALQLAKQSAQQETAIYVLTKQSD 149

  Fly   195 IGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHDGGVAPALNFAS 259
            :.:||::|||::.::.||||||||||||||||||||.|||.||:||.|.|:..:.|.||.|||||
  Fly   150 VSNLAKQLNALKTSSTNKPEVHFVKYRTPEDAANAQLAIQNQYNQLPGVSRISNEGRAPVLNFAS 214

  Fly   260 AGPVQKA-----NAQIPDNAYLPTSV----------FRRLR 285
            : |.|.|     .|..|.:.|||.:|          .||.|
  Fly   215 S-PAQAAAIPAVAAAAPSSEYLPANVVAGQDYLPPNLRRFR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 60/100 (60%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 60/99 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443811
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.