DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and TwdlS

DIOPT Version :9

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster


Alignment Length:157 Identity:58/157 - (36%)
Similarity:83/157 - (52%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LGGLGGLGGGDALAAPVSYNAPAPAAELQKEFFTYSANEQD-----FDEPQELERVAGSVNKGLR 156
            ||...|||   .:..|.. |..:...:|..|:|||:|..:|     :...:||.:|   ::...:
  Fly    24 LGFCHGLG---EVYLPAE-NEVSSGGKLATEYFTYAAPPEDDQVAPWQSARELAKV---LSPPQQ 81

  Fly   157 VVFIKGPENRGLENAALALAKQ-AAQQETAIYVLNKQADIGDLAQKLNAIRNNNNNKPEVHFVKY 220
            ||||:.||.    |.....||| |......|:||::|||...||::..||:...:.||.||||||
  Fly    82 VVFIRTPET----NIFTLTAKQLAVNNPLDIFVLHRQADADALAKQQAAIQQQVSEKPSVHFVKY 142

  Fly   221 RTPEDAANAQRAIQGQYDQLGGSSQAH 247
            |||.|...|..|::..||:|.|:|.:|
  Fly   143 RTPADVTRALSALRSDYDRLPGNSISH 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 40/106 (38%)
TwdlSNP_651491.1 DM5 45..145 CDD:214776 40/106 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443944
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.