DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and TwdlJ

DIOPT Version :9

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster


Alignment Length:314 Identity:175/314 - (55%)
Similarity:193/314 - (61%) Gaps:68/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIV---LCLVAVTCADKLGYNYQPVGHSSSGLSFAPGSGSISGGSIGGGSIGGGSIGGGSIG 62
            ||.|.|   |||..:..|||||||||||.||.|||||.| |||.|..:.........|.|.|.  
  Fly     1 MRQFSVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQP-SGSASSDAPAFAPAPSESFGPGP-- 62

  Fly    63 GGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKE 127
                                .||.              ..|.|..:.|||   |..||.|:|:||
  Fly    63 --------------------SSIA--------------DALEGSQSAAAP---NYAAPQAQLEKE 90

  Fly   128 FFTYSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQ 192
            ||||:|:|.||.:|...:|||.:|||||||||||||||||||:||||||||||||||||||||||
  Fly    91 FFTYTADEGDFYDPAASDRVANAVNKGLRVVFIKGPENRGLEDAALALAKQAAQQETAIYVLNKQ 155

  Fly   193 ADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHDGGVAPALNF 257
            |||||||.|||:||||||||||||||||||||||||||.|||||||||||||||.|||||..|||
  Fly   156 ADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQYDQLGGSSQAQDGGVASTLNF 220

  Fly   258 AS-AGPVQKANAQ------------------------IPDNAYLPTSVFRRLRF 286
            || ..|||.|::|                        .|.::|||.::.|||||
  Fly   221 ASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPPATPGSSYLPANILRRLRF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 84/100 (84%)
TwdlJNP_651489.2 DM5 85..186 CDD:214776 84/100 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8UZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.