DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and TwdlP

DIOPT Version :9

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster


Alignment Length:288 Identity:137/288 - (47%)
Similarity:166/288 - (57%) Gaps:72/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVLCLVAVTCADKL-GYNYQPVGHSSSGLSFAPGSGSISGGSIGGGSIGGGSIGGGSIGGG 64
            |||.|:|.:||...|..| ||||              |.|:.:                      
  Fly     1 MRALIILSIVAAASAGSLSGYNY--------------GQGATT---------------------- 29

  Fly    65 LIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFF 129
                           |:|||                 |:....|||.||||:| ||.|.:.|||:
  Fly    30 ---------------SIGGS-----------------GVSPVPALAGPVSYSA-APQASVHKEFY 61

  Fly   130 TYSANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQETAIYVLNKQAD 194
            ::.||:.||::...|:|...||.|.:||:|||.|||||.|||.||||||||||:||||||:||.|
  Fly    62 SFYANDDDFEDKAALQRALASVKKNIRVIFIKSPENRGYENAVLALAKQAAQQQTAIYVLHKQTD 126

  Fly   195 IGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHDGGVAPALNFAS 259
            |.:||||.||:|.|.|.|||||||||||||||||||||||.||||||||||:.:||||.|:||||
  Fly   127 INELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQSINGGVANAINFAS 191

  Fly   260 AG--PVQKANAQIPDNAYLPTSVFRRLR 285
            .|  |.:....|:|.:.|||.::..|||
  Fly   192 QGAAPARVTPQQVPQSNYLPANILSRLR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 65/100 (65%)
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 61/94 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.