DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and TwdlF

DIOPT Version :9

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster


Alignment Length:353 Identity:94/353 - (26%)
Similarity:142/353 - (40%) Gaps:121/353 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRAFIVL-CLVAVTCADKLGYNYQ------PVGH-------SSSGLSFAPGSGSISGGSIGGGSI 51
            |:.|:|| ||||:|.....||.||      |:|:       ||||:.   .||::......|.. 
  Fly     1 MKQFVVLMCLVALTATAPQGYKYQPQLPALPIGNLRPLTPISSSGIY---ASGAVPSFPQAGAQ- 61

  Fly    52 GGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYN 116
                                           .:||   :...:..:..:        :|||....
  Fly    62 -------------------------------PAIG---VQPAIQAVQTI--------VAAPAPAP 84

  Fly   117 APAP-AAELQKEFFTYSANEQDF--------------DEPQE----------------------- 143
            |||| :..|.||.|..::.:|:.              .:||:                       
  Fly    85 APAPLSISLPKETFLTASPQQNLISTVQQQPQQIVYQQQPQQALQTQFVQRPAIVTKDIYIHSAP 149

  Fly   144 ------------LERVAGSVNKGLRVVFIKGP-ENRGLENAALALAKQAAQQETAIYVLNKQADI 195
                        ||.|  .:.|..|:||||.| :|.....|||..|:.:.:::|.||||:|:.|:
  Fly   150 EENEELRQDEPLLENV--PIRKNYRIVFIKAPSQNLKYTAAALKRAQSSNEEKTVIYVLSKKPDL 212

  Fly   196 GDLAQKLNAIRNNNN-NKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHDGGVAP------ 253
            .::.|:|...::... .||||:|:||:|.|:|..||:.||.|||.|||::...|.||||      
  Fly   213 TEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYDALGGATHISDEGVAPIASVSS 277

  Fly   254 -ALNFASAGPVQKANAQIPDNAYLPTSV 280
             :||..|..|......|...::..||.:
  Fly   278 GSLNLGSFVPQHSQAGQTIIHSQAPTII 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 38/151 (25%)
TwdlFNP_649443.1 DM5 137..241 CDD:214776 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.