DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and Twdlalpha

DIOPT Version :10

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_728020.1 Gene:Twdlalpha / 326223 FlyBaseID:FBgn0052574 Length:388 Species:Drosophila melanogaster


Alignment Length:113 Identity:24/113 - (21%)
Similarity:37/113 - (32%) Gaps:44/113 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DTVTVKQSNSK----KVKFCYTP------KDVPRSFADPSYLKITIRLDH--------------- 150
            |:...:|:|.|    .|:..|:|      ||.|..:...:..|....:.|               
  Fly   396 DSYDAQQANYKWNTHTVQNLYSPTCNYESKDSPFGWCRHTMQKFVNNVKHKMFILNALPEINRSI 460

  Fly   151 ---FAPL------PTVEDSLYIQLV---------ATQKRECSGSKDEL 180
               .||:      |.|.|.:.|...         |..:::| |.|.||
  Fly   461 VMKIAPMLKNGTDPVVIDKMLINATSNSLSRKRYAQLEKDC-GGKCEL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 20/98 (20%)
TwdlalphaNP_728020.1 DM5 171..270 CDD:214776
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.