DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlB and TwdlY

DIOPT Version :9

Sequence 1:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_728017.1 Gene:TwdlY / 318093 FlyBaseID:FBgn0052570 Length:247 Species:Drosophila melanogaster


Alignment Length:228 Identity:81/228 - (35%)
Similarity:113/228 - (49%) Gaps:38/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IGGGS--IGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFFTYSA 133
            |||||  :||..:|||.|        |||..:....|||....|.| ...||.  :.|:|:..||
  Fly    34 IGGGSAPVGGVGIGGSSG--------GGLVSIQPHRGGDKYLPPAS-TTLAPI--INKKFYLVSA 87

  Fly   134 NEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQE--TAIYVLNKQ---A 193
            .|...::.:....|.|...|..||||||.|..   :||.:..:.:.|.||  |.||||:|:   .
  Fly    88 PEDHSNDGKVKHLVLGRPQKNYRVVFIKAPAG---DNANVKYSAEFAPQEEKTVIYVLSKKDNDV 149

  Fly   194 DIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHDGGVAPALNF- 257
            |..|:|..    .....:||||.|:||:|.::|..||:.||||||:|||:::..:...||..:. 
  Fly   150 DASDIATP----APTQPSKPEVFFIKYKTDDEAKQAQQEIQGQYDKLGGTNEYQEDNNAPITSVI 210

  Fly   258 ---------ASAGPVQKAN---AQIPDNAYLPT 278
                     .|....|.||   |.:|::.|||:
  Fly   211 GSLDGLNPDGSYNYRQIANRPPAVVPNSQYLPS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlBNP_651486.1 DM5 122..223 CDD:214776 36/105 (34%)
TwdlYNP_728017.1 DM5 76..175 CDD:214776 37/107 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443832
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.