DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlP and Dspp

DIOPT Version :9

Sequence 1:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_034210.2 Gene:Dspp / 666279 MGIID:109172 Length:945 Species:Mus musculus


Alignment Length:83 Identity:20/83 - (24%)
Similarity:35/83 - (42%) Gaps:17/83 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VLALAKQAAQQQTAIYVL-HKQTDI-NELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQ 166
            ::.|.:...:...|:.:| |..|.. |||:  .|:...|:|..|           |.:.....:.
Mouse    23 LVPLERDIVENSVAVPLLTHPGTAAQNELS--INSTTSNSNDSP-----------DGSEIGEQVL 74

  Fly   167 SQ--YDQLGGSSQSINGG 182
            |:  |.:.|..|:||:.|
Mouse    75 SEDGYKRDGNGSESIHVG 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 12/49 (24%)
DsppNP_034210.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..98 15/58 (26%)
2A1904 <126..>367 CDD:273344
CDC27 <326..>476 CDD:286580
Cell attachment site. /evidence=ECO:0000255 479..481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BBVW
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.