DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlP and CG34305

DIOPT Version :9

Sequence 1:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001097671.1 Gene:CG34305 / 5740825 FlyBaseID:FBgn0085334 Length:79 Species:Drosophila melanogaster


Alignment Length:58 Identity:23/58 - (39%)
Similarity:34/58 - (58%) Gaps:3/58 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 AVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQSINGGVANAINFASQG 193
            |...||   |.|..::|:...|.||.||||.:||:::||:::......||.:|.||.|
  Fly    22 AATDNA---PTVSVLRYKDDRDLANIQRAIIAQYERIGGTTKVHQPLTANIVNPASLG 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 5/15 (33%)
CG34305NP_001097671.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.