DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlP and TwdlC

DIOPT Version :9

Sequence 1:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:217 Identity:54/217 - (24%)
Similarity:89/217 - (41%) Gaps:58/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AASAGSLSGYNYGQGATTSIGGSGVSPVPALAGPVSYSAAPQ-ASVHKEFYSFYANDDDFEDKAA 75
            ||:|..|:.|:........:.|     |...:|   |:..|| ..|||..| .:....|||::.|
  Fly    90 AAAAEPLNAYDDSYNMAHRLSG-----VQHASG---YNNGPQETKVHKHIY-VHVPPKDFEEEDA 145

  Fly    76 LQRAL----ASVKKNIRVIFIKSPENRGYENAVLALAKQAAQQQTAIYVLHKQTDINELAQKFNA 136
            :|..:    ...:|:.:::|||:|........|:....| .:::|.||||||:.:     |:.:.
  Fly   146 IQTRVHHQQGPKQKHYKIVFIKAPSAPAIRQPVVPPPPQ-NEEKTLIYVLHKKPE-----QEQDI 204

  Fly   137 V----RQNANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQSINGGVANAINFASQGAAPA 197
            |    ......||||:|:||:|.:|.|..                              .|..||
  Fly   205 VIPTPPPTKPSKPEVYFIKYKTKKDEAPV------------------------------YGPPPA 239

  Fly   198 RVTPQQVPQSNYLP----ANIL 215
            .:.|:|....::.|    |::|
  Fly   240 EMEPRQATAEDFAPLAEVADVL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 29/102 (28%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.