Sequence 1: | NP_651485.1 | Gene: | TwdlP / 43201 | FlyBaseID: | FBgn0039435 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651494.1 | Gene: | Tb / 43212 | FlyBaseID: | FBgn0243586 | Length: | 283 | Species: | Drosophila melanogaster |
Alignment Length: | 281 | Identity: | 106/281 - (37%) |
---|---|---|---|
Similarity: | 143/281 - (50%) | Gaps: | 69/281 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MRALIILSIVAAASAGSLSGYNYGQGATT--------------------------------SIGG 33
Fly 34 SGVSPVPALAGPVSYSAAP-QASVHKEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPEN 97
Fly 98 RGYENAVLALAKQAAQQQTAIYVLHKQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQ 162
Fly 163 RAIQSQYDQLGGSSQSINGGVANAINFA--------------------------SQGAAPARV-- 199
Fly 200 -------TPQQVPQSNYLPAN 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TwdlP | NP_651485.1 | DUF243 | 57..152 | CDD:281144 | 51/94 (54%) |
Tb | NP_651494.1 | DM5 | 86..187 | CDD:214776 | 54/100 (54%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45443808 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000952 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR31927 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.940 |