DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlP and TwdlH

DIOPT Version :9

Sequence 1:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_651490.1 Gene:TwdlH / 43208 FlyBaseID:FBgn0051080 Length:241 Species:Drosophila melanogaster


Alignment Length:240 Identity:126/240 - (52%)
Similarity:155/240 - (64%) Gaps:28/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRALIILSIVAAASAGSLSGYNYGQGAT----TSIGGSGVSPVPALA----------GPVSYS-- 49
            ||.||.|.:|||.||  .|||||...|:    .|...||.|..|::|          .|.|..  
  Fly     1 MRVLIALCLVAAVSA--RSGYNYQPAASAPAVASFAPSGPSYSPSVAASQDAPAETYAPASAPEA 63

  Fly    50 ---------AAPQASVHKEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPENRGYENAVL 105
                     |||||.:.|||:::.|::.||.:.|..|:..||:.|.:||||||.|||.|.|||.:
  Fly    64 APSAVATNYAAPQAELQKEFFTYTADEQDFVEPAGSQQVSASLNKALRVIFIKGPENTGLENAAV 128

  Fly   106 ALAKQAAQQQTAIYVLHKQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYD 170
            ||||||.||:||||||:||.||.:|:.|.|::|.|.|.|||||||||||.:||.|||:|||||||
  Fly   129 ALAKQAGQQETAIYVLNKQADIGDLSNKLNSIRNNNNNKPEVHFVKYRTNQDALNAQQAIQSQYD 193

  Fly   171 QLGGSSQSINGGVANAINFASQGAAPARVTPQQVPQSNYLPANIL 215
            ||||||..:|||||..:|||||.|| .:|.....|.|:||||::|
  Fly   194 QLGGSSTILNGGVAPVLNFASQPAA-QQVAAPSAPGSSYLPASVL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 55/94 (59%)
TwdlHNP_651490.1 DM5 77..178 CDD:214776 59/100 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.