DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlP and TwdlN

DIOPT Version :9

Sequence 1:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:310 Identity:144/310 - (46%)
Similarity:177/310 - (57%) Gaps:93/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRALIILSIVAAASAGSLSGYNY----------------------GQGATTSIGGS-------GV 36
            |||.::|.:||.|||..| ||||                      |.|.:..:|||       |.
  Fly     1 MRAFVVLCLVAIASADKL-GYNYKPVGHSSSGLSFAPGSGSLSLGGGGGSLGLGGSSGSLDLGGA 64

  Fly    37 SPVPALAG--------------------------------------------------------- 44
            |....|.|                                                         
  Fly    65 SGSLGLGGGSNFGSLDGGFGGLGGGSIDLGSSGLGSSGLGSGLGSSGLGSGLGSSGLGSGLGSAG 129

  Fly    45 ---PVSYSA-APQASVHKEFYSFYANDDDFEDKAALQRALASVKKNIRVIFIKSPENRGYENAVL 105
               ||||:| ||.|.:.|||:::.||::||::..||:|..:||.|.:||:|||.|||||.|||.|
  Fly   130 LSAPVSYNAPAPAAELQKEFFTYTANEEDFDEPQALERVASSVNKGLRVVFIKGPENRGLENAAL 194

  Fly   106 ALAKQAAQQQTAIYVLHKQTDINELAQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYD 170
            |||||||||:||||||:||.||.:||||.||:|.|:|.|||||||||||||||||||||||||||
  Fly   195 ALAKQAAQQETAIYVLNKQADIGDLAQKLNAIRSNSNNKPEVHFVKYRTPEDAANAQRAIQSQYD 259

  Fly   171 QLGGSSQSINGGVANAINFASQGAAPARVTPQQVPQSNYLPANILSRLRH 220
            |||||||:||||||||:||||.|  |.|....|:|:::|||:::|.|||:
  Fly   260 QLGGSSQAINGGVANALNFASAG--PVRQATAQIPENSYLPSSVLRRLRY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 62/94 (66%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 66/100 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.