DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlP and TwdlW

DIOPT Version :9

Sequence 1:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_650606.2 Gene:TwdlW / 42075 FlyBaseID:FBgn0038487 Length:308 Species:Drosophila melanogaster


Alignment Length:237 Identity:80/237 - (33%)
Similarity:112/237 - (47%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YNYGQGATTSIGGSGVSPVPALAGPVSYSAAP---------------QASVHKEFYSFYA---ND 67
            ::..|.|.....||  .|:|| ..||::..||               :..|.|.|:...|   ::
  Fly    82 FHSAQPAVRPTAGS--FPMPA-GFPVNFQTAPIQQQRRARPRVRIPKRPIVTKNFFIHSAPEESE 143

  Fly    68 DDFEDKAALQRALASVKKNIRVIFIKSP--ENRGYENAVLALAKQAAQQQTAIYVLHKQTDINEL 130
            |:.:|:  |.:.....:.:..|:|:|:|  .||.   |.|.|||...|::|.:|||.|:|..::|
  Fly   144 DEVQDE--LNQLAQQPRNHYNVLFVKTPAQTNRA---AALNLAKTLKQEKTVVYVLAKKTTASDL 203

  Fly   131 AQKFNAVRQNANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQSINGGVANAIN------- 188
            ........|:.| ||||.|:||||||:|.||||.||||||.|||||...:.|||...:       
  Fly   204 QDAIAEAPQHIN-KPEVFFIKYRTPEEALNAQRQIQSQYDTLGGSSTITDEGVAPITSVVGSLDP 267

  Fly   189 -----------------FASQGAAPARVTPQQVPQSNYLPAN 213
                             ||..||..:.|.|   ..::|||||
  Fly   268 PEEEEEEQQQQQHSEGQFAENGAGNSGVGP---IGNHYLPAN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 32/99 (32%)
TwdlWNP_650606.2 DM5 127..227 CDD:214776 36/105 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443893
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.