DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlP and TwdlG

DIOPT Version :9

Sequence 1:NP_651485.1 Gene:TwdlP / 43201 FlyBaseID:FBgn0039435 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster


Alignment Length:284 Identity:84/284 - (29%)
Similarity:119/284 - (41%) Gaps:87/284 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILSIVAAASAGSLSGYNY------------GQGATTSI--------------------------G 32
            |:..:...:||...||||            ||....||                          |
  Fly     5 IVPCLLGLAAGIPQGYNYQAQQQLQSSAQAGQLHLPSIPQFATLAEQTILQQALQAPKLQQVLTG 69

  Fly    33 GSGVSPV----PALA--------GPVS-YSAAPQAS-------VHKEFYSFYANDDDFEDKAALQ 77
            |.|::..    .|.|        ||.| |:|.|||.       |.|:.|......::.||:.. |
  Fly    70 GEGLASYSNQNQASAYQQQATQFGPNSAYNALPQAHQPQQQHLVSKDIYVHVPPAEEPEDRYP-Q 133

  Fly    78 RAL--ASVKKNIRVIFIKSPENRGYENAVLALAKQAAQQQTAIYVLHKQTDINELAQKFNAVRQN 140
            ..|  |..:|:.|::|||:| ......|.|.:.:...:::|.||||.|:.|..:|......:...
  Fly   134 PVLPPAPPRKHYRIVFIKAP-TTSVSKAALRIKQAPVEEKTIIYVLTKKPDPLDLQTAIEEIAPK 197

  Fly   141 ANKKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQSINGGVA--------------NAINFAS 191
            ...||||.|:||:|.|:||:|||.||:|||||||:||..:.|||              |.|:...
  Fly   198 QPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGVAPVTSVIGVLDNQRNNGISSGQ 262

  Fly   192 -QGAAPARVTPQQVPQSNYLPANI 214
             .|:.|          ::|||.|:
  Fly   263 FSGSLP----------NSYLPTNL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlPNP_651485.1 DUF243 57..152 CDD:281144 28/96 (29%)
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 31/100 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.